PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG026858.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family EIL
Protein Properties Length: 596aa    MW: 66884.5 Da    PI: 5.1979
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG026858.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN34394.2e-134383741323
                  XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
         EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkek 98 
                  e+l++rmwkd+++lkrlke++k    +++ a++++k +++++qarrkkmsraQDgiLkYMlk mevc+a+GfvYgiipekgkpv+gasd++raWWkek
  CCG026858.1  38 EDLERRMWKDRIKLKRLKEKQKLA--AQQ-AAEKQKPKQTSDQARRKKMSRAQDGILKYMLKLMEVCKARGFVYGIIPEKGKPVSGASDNIRAWWKEK 132
                  89****************999963..355.599***************************************************************** PP

                  XXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.---- CS
         EIN3  99 vefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppyk 196
                  v+fd+ngpaai+ky+a++l++++++++  ++ ++++ l++lqD+tlgSLLs+lmqhcdppqr++plekgv+pPWWPtG+e+ww +lgls+ q+ ppyk
  CCG026858.1 133 VRFDKNGPAAIAKYEAECLAMGEAENS--KNGNSQSALQDLQDATLGSLLSSLMQHCDPPQRKYPLEKGVPPPWWPTGNEDWWVKLGLSQGQS-PPYK 227
                  **********************99888..7899***********************************************************9.9*** PP

                  -GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX.........XXXXXXXXXXXXXXXXXXXX CS
         EIN3 197 kphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss.........slrkqspkvtlsceqkedve 285
                  kphdlkk+wkv+vLtavikhmsp+i +ir+++rqsk+lqdkm+akes+++l vl+qee+++++ s+++            + q++k  +s+++++dv+
  CCG026858.1 228 KPHDLKKMWKVGVLTAVIKHMSPDIPKIRRHVRQSKCLQDKMTAKESAVWLGVLSQEESLIRQPSSDNGtsgvtetpqGGNGQKKKRAISSDSDYDVD 325
                  *******************************************************************4444676655433449999************ PP

                  XXXXXX.XXXXXXXXXX..................XXXXXXXXXXXXXXXXXXXXX CS
         EIN3 286 gkkeskikhvqavktta..................gfpvvrkrkkkpsesakvssk 323
                  g ++   + ++++++++                  +    +k   + ++++   ++
  CCG026858.1 326 GADDGVGSVSSKDSRRNqsmdveplnsrddatnpvQ----DK---ELGKKQPRRKR 374
                  777777677777776666777777777765533331....22...22222222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048734.0E-12738285No hitNo description
Gene3DG3DSA:1.10.3180.101.3E-71159293IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167683.66E-62166289IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042762Biological Processregulation of sulfur metabolic process
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 596 aa     Download sequence    Send to blast
MGELEEIGAD ICSDLEADDI RCDTIAEKDV TDEEIEAEDL ERRMWKDRIK LKRLKEKQKL  60
AAQQAAEKQK PKQTSDQARR KKMSRAQDGI LKYMLKLMEV CKARGFVYGI IPEKGKPVSG  120
ASDNIRAWWK EKVRFDKNGP AAIAKYEAEC LAMGEAENSK NGNSQSALQD LQDATLGSLL  180
SSLMQHCDPP QRKYPLEKGV PPPWWPTGNE DWWVKLGLSQ GQSPPYKKPH DLKKMWKVGV  240
LTAVIKHMSP DIPKIRRHVR QSKCLQDKMT AKESAVWLGV LSQEESLIRQ PSSDNGTSGV  300
TETPQGGNGQ KKKRAISSDS DYDVDGADDG VGSVSSKDSR RNQSMDVEPL NSRDDATNPV  360
QDKELGKKQP RRKRPCVRSS HADQHPQPQL NDDHVGVERT STLPDINHTD LQPVEYQMHD  420
TQHENFTSST LRPLENGFVG ESNLPQSDFN YYAGVPSANV NSTEKIYADK GPAFYPLGQN  480
SGLPHETTYS NFYNPSLDYG TNHDRRPSQM TMSIGQEDDR FHIPAPQGNE NDLTGGEPHH  540
LIKDTFPTEQ DGAVDRQFEF DLPDFAINSP FLEMSSFSLD DLFVDPEDEL IQCFGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A2e-751652969140ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00233DAPTransfer from AT1G73730Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2142770.0AC214277.1 Populus trichocarpa clone ACSB1145-L17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011037881.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
SwissprotO231160.0EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLB9GMA10.0B9GMA1_POPTR; ETHYLENE-INSENSITIVE3-like 3 family protein
STRINGPOPTR_0001s05360.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-171ETHYLENE-INSENSITIVE3-like 3